DPCstruct | MC36586
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 112 ± 16 aa |
| Standard deviation of domain lengths | 15.98 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19754 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W7Z627 | 17-122 | DTMSEYDMQEAIHYMSHGLVQANQKWGKIELTEDRVERLLYVAEFNEDTYTHGNRYITILMGWNIGDFSNAVDDHNFIWGLWNGTVG… |
| A0A7X2IXS2 | 2-104 | SESAVQSAIYALSHQKVAAQDKWSHLLITPERISRLIEVVEHNKDNFQHTNLYLDILYSWRDGDYSNSVKAHNDIWALQSGTIGIAT… |
| U2DB87 | 46-147 | None |
| A0A1H0MSD9 | 65-167 | None |
| A0A1C6KT22 | 87-201 | None |
| A0A0B5SIG0 | 2-83 | None |
| A0A5J6SNJ2 | 37-162 | None |
| A0A0C2R4J1 | 20-136 | None |
| A0A2J9PN17 | 75-210 | None |
| A0A1Y3M920 | 38-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.