DPCstruct | MC36580
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 124 ± 16 aa |
| Standard deviation of domain lengths | 15.87 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A858RJ96 | 97-224 | LSDLIAESPGSDGYLCSIELFFDGNEEIGSIAANLTDHPGLVAFRECLMEIRKRAEVEAVLLGVVDFPPGEWPYVETILVFTSAAPE… |
| A0A4Q7KID1 | 9-119 | IERQGDPAAVGLELFFDGNDDPASIGCNLDEHPGVGTFARVLRAVRDRPEVDDVLVGISEVMPDGEWPFSDTVHVLTAASAGDVAGW… |
| A0A2D9JB15 | 189-335 | None |
| A0A650MI75 | 7-98 | None |
| A0A439HT35 | 5-98 | None |
| A0A2A7MIR4 | 176-296 | None |
| J2KE26 | 134-248 | None |
| A0A3M2CFA6 | 120-242 | None |
| A0A7T5CIS6 | 51-193 | None |
| A0A1E7N9N9 | 2-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.