DPCstruct | MC36575
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 124 ± 17 aa |
| Standard deviation of domain lengths | 17.23 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 94.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 24.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0742 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C4GQP1 | 7-100 | ADKSVYDLSEGLKRHLLEGGGIEIEIIVGELRFALRAEGHPELKLSDPRDLVIRKSSYIDGRTLAIRATASSAELPREMVRALRDPE… |
| A0A7T5RTG4 | 2-125 | VRSLHPTTIEVTADEHLTEKGDCIVGVGATKGCAQLDEAVKSGLRRPGSRVKVTLKVGGASFVVRAGGDPGLELTHPGEIVIRRSGF… |
| A0A662P795 | 206-326 | None |
| A0A2I0QM32 | 176-316 | None |
| A0A7J3BEK0 | 2-85 | None |
| A0A7J3E2P4 | 65-195 | None |
| A0A7Y0DXP9 | 3-130 | None |
| A0A1Q7VXX9 | 6-132 | None |
| W7J0K0 | 5-134 | None |
| A2BJJ4 | 5-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.