DPCstruct | MC36574
Metacluster Properties and Pfam Annotations
| Number of structural domains | 129 |
|---|---|
| Mean domain length (aa) | 178 ± 43 aa |
| Standard deviation of domain lengths | 43.08 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 91.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 19.97 |
| Pfam Score | 81.82 |
| Assigned Pfam label(s) | PF02511- CL0339 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T5RQ94 | 24-171 | PFEPEALMDHVVYMFEIEDCSRITTHQLVRHRVASYDQESQRFSAATREGVVTPKSIESNEAAYKAFDEALKAVYASYEKMAAAGVP… |
| A0A654ZIA5 | 5-157 | ASVSFYITGISRSCTHELIRHRHFSYSQLSQRYVPEKDSRVVVPPGMEDDADLRHILTEAADAARATYSELLAKLEAKFADQPNAIL… |
| Q74N47 | 13-248 | None |
| R6H3S8 | 306-547 | None |
| A0A7J2HS50 | 47-235 | None |
| A0A1F5AY69 | 7-137 | None |
| A0A7V9UES6 | 321-457 | None |
| A0A2H5YF89 | 2-142 | None |
| A0A662MEU5 | 51-298 | None |
| A0A0G1FZA5 | 4-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.