DPCstruct | MC36572
Metacluster Properties and Pfam Annotations
| Number of structural domains | 125 |
|---|---|
| Mean domain length (aa) | 175 ± 25 aa |
| Standard deviation of domain lengths | 24.78 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.16 |
| Pfam Score | 76.78 |
| Assigned Pfam label(s) | PF04561- CL0410- PF04563- CL0028- PF04565 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J3DL87 | 19-196 | ADRLAKAFYLGMMASKAIETYYNLRQEDDKDHYANKRLELSGKLMEHLFRYAFKYFVKDLKFQIDRTVTRRRKLNINTIVRPDAITE… |
| W4UJW2 | 20-172 | VVEPDDIDHFGNRRLRTVGELIQNQLRTGLSRMERVVRDRMTTQDIEAITPQTLINIRPVTAAIKEFFGTSQLSQFMDQNNPLAEMT… |
| A0A6S8SMV0 | 63-271 | None |
| A0A2G3D3A9 | 77-224 | None |
| A0A426H4V6 | 24-207 | None |
| A0A345HH11 | 224-427 | None |
| A0A2G3BI38 | 60-256 | None |
| A0A1P8BFS9 | 314-532 | None |
| Q8HTL6 | 478-665 | None |
| A0A4S8I2F4 | 81-266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.