DPCstruct | MC3657
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 158 ± 19 aa |
| Standard deviation of domain lengths | 19.09 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 23.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A496Y6J1 | 1-141 | MQCPYCRKSFDPREAVAEAEWYDIISLIPEFGPYSKLVMEYCELFGVTPLRIKSKKLLRLLREAAVLFRNESFKFHKRQYRISRTGI… |
| A0A7T0BVJ7 | 1-153 | MILRCPTCGTTASFETWGNQDVQGCLKLFSEFPKPTPHSAVHYLTLFRPAKTVLTWKKAGKVLKELLEMIDSKTIKIPGEPEIGITP… |
| A0A660NBR3 | 1-166 | None |
| A0A450YYK1 | 34-190 | None |
| K2IXQ2 | 1-146 | None |
| A0A3N0V7S2 | 1-157 | None |
| A0A3P1YF53 | 2-195 | None |
| A0A248LND6 | 1-169 | None |
| A0A1A6C8C3 | 1-138 | None |
| G4CJH3 | 45-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.