DPCstruct | MC36561
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 160 ± 18 aa |
| Standard deviation of domain lengths | 18.38 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 35.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0542 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5F5PQK2 | 1-171 | MPQTPPFSAMFDSSGYNRNLYQSAEDSCGGLYYHDNNLLSGSLEALIQHLVPNVDYYPDRTYIFTFLLSSRLFMHPYELMAKVCHLC… |
| A0A7E4REM0 | 1-142 | MAVMYREGNLVSGRLEALVQHMVPTVDYYPDRAFLFAFLLTSRLFIKPHDLLGQIFALSESQLKAKNATAKERAQLLPRLVQLLGEW… |
| A0A6J2UY15 | 10-185 | None |
| A0A6G0ZKB4 | 1-152 | None |
| A0A674K871 | 1-160 | None |
| A0A5F4W4E8 | 164-345 | None |
| A0A674DTX1 | 1-158 | None |
| A0A819R8F6 | 170-329 | None |
| A0A1A9UKU4 | 134-254 | None |
| B4JQM0 | 66-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.