DPCstruct | MC36560
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 629 ± 113 aa |
| Standard deviation of domain lengths | 112.68 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 75.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 20.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A270P5R8 | 2-474 | AALLLDLDATPGLPRNHVAGYNLTQAGNWGAKPSTVVTRLEAHLVAGGKVTSTTAPVAAYHLLAGTAPEFLVRDMPDNLVCGSHTWT… |
| A0A0J6INC8 | 2-709 | KKNILASVRNNAIALDEFEYLRRSKDALGYLTQSRQWSPEELSDPRAFLTNLLNTPEAYALGKALQTQFKGAPSATSINDWAMTAIA… |
| A0A3R8W7P1 | 55-798 | None |
| A0A7T4REU1 | 71-625 | None |
| A0A4Y9TDV0 | 49-784 | None |
| A0A3Q9D8C3 | 3-502 | None |
| A0A2G0XB50 | 326-856 | None |
| A0A2G0XBN7 | 2-693 | None |
| A0A7Y8KGU4 | 17-573 | None |
| A0A1B5EW97 | 553-1131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.