DPCstruct | MC3656
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 92 ± 15 aa |
| Standard deviation of domain lengths | 14.98 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A554MNZ6 | 6-109 | GFKHDKYKNTRGGYSRWLLIACEKCKVPVCLYQKDGPGILKRLYLDRVIAPVKLCGLQKNALKKIEKLVCSHCSFLLGVPIIYEKEN… |
| A0A7T0BV81 | 3-90 | SRVLNLICRHCSASVLRYKKSGSGKLIRIYLDRVVEPLELARLKSAGSKNELPPLHCSGCGTSLGMPMVESGRLAYRVLPGTLGKQKD |
| A0A7S3V413 | 53-173 | None |
| D7FNB7 | 132-219 | None |
| A0A1G7YTV3 | 16-104 | None |
| A0A3C8C6H5 | 2-75 | None |
| A0A0G0BK62 | 17-126 | None |
| A0A5J4YKS1 | 340-425 | None |
| A0A6L9J5X0 | 4-106 | None |
| A0A2H9T7A6 | 1-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.