DPCstruct | MC36559
Metacluster Properties and Pfam Annotations
| Number of structural domains | 417 |
|---|---|
| Mean domain length (aa) | 118 ± 23 aa |
| Standard deviation of domain lengths | 23.32 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 89.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 20.21 |
| Pfam Score | 95.50 |
| Assigned Pfam label(s) | CL0170- PF18979- CL0363- CL0381 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A349PL50 | 30-136 | SEFTCKCGKCRNQLIGMKMISLLQQVREKMGVPLYIKSAYRCPTHNANVGGVTNSRHTYGDAIDVSISNLDWHELVKVAKEVGFTGI… |
| K7GFP7 | 104-190 | RCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKA |
| A0A3D1Q0H9 | 20-137 | None |
| A0A3Q4HID3 | 17-113 | None |
| A0A0C9RYX5 | 4-90 | None |
| A0A7L5XYN1 | 233-327 | None |
| A0A1V5VJ71 | 141-253 | None |
| A0A538Q7D4 | 114-227 | None |
| A0A3C0GIT2 | 5-106 | None |
| A0A495PMF3 | 12-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.