DPCstruct | MC36554
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 85 ± 9 aa |
| Standard deviation of domain lengths | 9.21 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 28.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0098 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U9D1S8 | 1-103 | MTVEIVSGERDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLDAERLQKKIQQWQKIAIAACEQSGRNVVP… |
| A0A1A6C0P0 | 70-154 | ADNATESALDLGLVQGISKGDHMDLTIQKAVELGVRRILPLTCLRSQRIPPDRLARRMAHWRAIAISACEQSGRSHLPELLPPVT |
| A0A496TET9 | 78-154 | None |
| A0A811MLQ9 | 120-195 | None |
| A0A380LK65 | 71-147 | None |
| A0A225MPI1 | 67-153 | None |
| A0A2B4QYH1 | 89-158 | None |
| A0A2M6Y6P1 | 87-174 | None |
| D7MMJ2 | 1-71 | None |
| A0A1Y6MKE3 | 45-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.