DPCstruct | MC36550
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 222 ± 16 aa |
| Standard deviation of domain lengths | 16.28 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 66.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 35.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D1Y824 | 1-227 | MAYVPPHKRHFKDADRPTPVPDSLVPQFRKNVNLRSPSTFQRGKDRSSFQGPKIVYASSCISRWWPVGSTDNDPIPESFHLECIPCE… |
| A0A218VSN7 | 1-200 | MLVPRFQKNLNLGSKPSMDKSGKIVCADTAIWRWFAVGLDGNETEGPPPVLLQRVPVEVIERINGEKPLALVRSSRLSEGQRTLDSS… |
| A0A498IKM8 | 148-356 | None |
| A0A5N5IYD9 | 35-240 | None |
| A0A2G3B2D0 | 5-217 | None |
| A0A6V7Q081 | 66-319 | None |
| B7EFP2 | 1-233 | None |
| A0A453NG47 | 29-256 | None |
| A0A5C7IA72 | 1-225 | None |
| A0A6N2KIM5 | 35-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.