DPCstruct | MC36549
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 110 ± 12 aa |
| Standard deviation of domain lengths | 12.22 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 36.97 |
| Pfam Score | 98.61 |
| Assigned Pfam label(s) | PF05608- CL0022 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D1XPR9 | 38-139 | GESTWDDALLRSTREFQHRSYNLFTCNCHSFVVNNLNRLSYGGHDNWNVVSLAAWVFLKGTWVNKKASVRSFLPFIVVLCIGILLAG… |
| A0A4Y7NL76 | 60-168 | MAFGVPTRYLQLDVTKIPGGVSAWDRAVHEASEEYKGHVHNLFCDNCHSHVAMAMNNMTYPGKHTWGMVSLCWFMLVKGKSVSLGAF… |
| H3G749 | 49-143 | None |
| A0A8B6DD01 | 318-409 | None |
| R7U154 | 15-108 | None |
| A0A7C9DSP6 | 12-129 | None |
| A0A4S4D9R1 | 330-442 | None |
| A0A0V0QGQ4 | 113-205 | None |
| A0A6V7NMN5 | 188-300 | None |
| A0A835RR77 | 264-389 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.