DPCstruct | MC36547
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 240 ± 15 aa |
| Standard deviation of domain lengths | 14.64 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 77.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 34.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F4GHM0 | 1-217 | MPSAGHYSDMQTLMQNMESLSGWLEQNRQEWSQVQEGIARVERLQGRLASNGSLPQVNGDTQAPLEEDNTTPTITQLQTALSQTTAR… |
| W2S6D0 | 54-316 | LDLPIRGASSASSGAGSYTGTNGASNNPTYASPLPAGHQQDLNYLYEQIQELSNLLRANRARTAELTRRAEQAEVSTQYSATQQLLT… |
| A0A6A5KKA6 | 2-245 | None |
| D4DH71 | 107-342 | None |
| A0A6A6PW42 | 30-253 | None |
| A0A2T6Z9Z7 | 1-264 | None |
| U1GNJ7 | 224-451 | None |
| A0A1W5D0N8 | 403-630 | None |
| A0A1V8TFF2 | 2-243 | None |
| A0A0U1M3U4 | 304-552 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.