DPCstruct | MC36545
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 299 ± 21 aa |
| Standard deviation of domain lengths | 21.05 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 74.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2RPZ0 | 1-340 | MPGAFPELSPPPSPPADMKRQNMSKSKKTKKKAEKKERQQEQEEEHVLDDSHHQGSTNESQQFPTPNASADLATPANTAASSLASLN… |
| A0A0F7VJQ8 | 827-1104 | AQGHQASTPATEVSEGNPPTSPCHVLDNPHRPCDRDAYPTPPTQTTTSSSEVLVQGLRYKRKEKESGKFFWDLTYHSFQCAKEGCLK… |
| A0A165A1C5 | 628-951 | None |
| A0A319DXP7 | 347-595 | None |
| A0A505HY95 | 129-416 | None |
| A0A0D2IT11 | 2-285 | None |
| A0A3D8QFN9 | 751-1068 | None |
| W9YJQ7 | 423-723 | None |
| U1GQJ2 | 272-565 | None |
| A0A3M2T1K3 | 631-924 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.