DPCstruct | MC36544
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 164 ± 22 aa |
| Standard deviation of domain lengths | 22.12 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 65.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.79 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 33.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12273 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2RMZ4 | 1-166 | MPSLHLIPRADDDDIVCNYWGCVSYTSYVIKWAVFGGLMAACLLFFFGGYIHAKQRMKKGLAPLSYHRWMIPRRQRIAFHAAHPNLP… |
| A0A0D2A3I8 | 50-170 | RTAEIIKWSIFLGLMGIIFIYFTVGYWHARRRIRKGLQPLRYHRWLAPKPFRQQNNAAYYNPQNGTYGMYPYPEPPPVYNPNGMPPM… |
| A0A317SJL4 | 17-171 | None |
| A0A6P8BK18 | 1-189 | None |
| A0A0D1ZSG4 | 1-168 | None |
| K1XCG4 | 72-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.