DPCstruct | MC3654
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 219 ± 32 aa |
| Standard deviation of domain lengths | 32.20 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 33.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0188 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A482S1Q3 | 1-153 | MEKIAFIVERLNQAPFKKDISTMAELDSKAGFELLDIMCEIVLNIDPEHEGILKEPIEFRARRIMQFLTVMKFAIPQDQYDDFLSLL… |
| A0A673XBF3 | 1-222 | MSKQLTFIVEHLNKDPFKKNVNLITFDSLGPMQLLEILNDVLAEIDPKRMFTLLGMLKYKPPGNMSDLSSFRQGLVTGSKHVIHPIL… |
| A0A4D9CNG0 | 5-252 | None |
| A0A0L0SU65 | 9-251 | None |
| A0A821QDG2 | 1-239 | None |
| A0A820E2Y4 | 1-137 | None |
| A0A0V0R1P3 | 37-274 | None |
| A0A2H1CEB9 | 1-194 | None |
| A0A6A4ZR55 | 3-192 | None |
| A0A336MJ98 | 1-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.