DPCstruct | MC36537
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 239 ± 27 aa |
| Standard deviation of domain lengths | 26.76 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 42.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q4SWD5 | 109-370 | ASVTASTRNNGRRRFFQPYMLDYYGDRGSYHGQKINGPGYGAPGSGSINDPEWNGMADPKWAPDSSKLVYWESQTRYPDCGGTNPLP… |
| X0H0X4 | 27-284 | TTVSSSIRNNGQRRFFSPWLLDAYGDRQSDNYYGQKINGPGSSKSGSGDLRDPEWNGQADPQWSPDSTQVVYWEAHVEAPACGGINP… |
| A0A366PVC2 | 738-1004 | None |
| A0A0U4Z377 | 867-1124 | None |
| A0A1U8QWQ5 | 164-392 | None |
| A0A4Q7K7K0 | 262-533 | None |
| W9J7D4 | 7-224 | None |
| A0A4S2H631 | 140-326 | None |
| A0A1B8E937 | 380-600 | None |
| A0A428QDR9 | 30-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.