DPCstruct | MC36536
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 132 ± 17 aa |
| Standard deviation of domain lengths | 16.96 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 28.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X0H0W9 | 1-171 | MSTSTISPVRRALGWNIVFLAGPDGENFAGVFHPPGSDSLTYRHILEEFRLCFVIPPVDLTSTNPWDEVSFFPAGTQGGYRRPLRNN… |
| A0A428U9T1 | 1-136 | MTSAAVNPTMRSHGWNIELLTVPGDVPFAGVFQPAKNVFMTFRDIINEMRLSFEFKDESSDVWNEVAFGLLDMLNVDEGEYPAPKFI… |
| A0A0B4H096 | 1-152 | None |
| W9J7W4 | 1-117 | None |
| A0A428PNS0 | 7-121 | None |
| A0A194W9V4 | 1-109 | None |
| A0A194W7F5 | 1-103 | None |
| A0A194W7C8 | 1-127 | None |
| A0A194W325 | 1-112 | None |
| A0A2N6ND83 | 1-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.