DPCstruct | MC36534
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4 |
|---|---|
| Mean domain length (aa) | 98 ± 9 aa |
| Standard deviation of domain lengths | 8.79 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 72.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 55.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12621 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H3GDN4 | 85-190 | VFKWLRTWIYADYATVDQLVHHEGRKELEHHQEAELHAYFPPSVTSQAPFLWVPADGDAGISKQEIFDTRKVIPVSNMGCKLDDRNH… |
| A0A0G2I692 | 229-318 | ARTGAETEPAPEYSEEDIKKAYQNPSLTSKAPLIWLPKDNYGLSKKEIESLSAEDLEATDEGAWVNSKGKVDFERSNLRGLPVWKQP… |
| X0C9A8 | 814-920 | None |
| X0GQX9 | 186-273 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.