DPCstruct | MC36533
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 297 ± 48 aa |
| Standard deviation of domain lengths | 48.23 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 69.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.75 |
| Mean length-normalized TM-Score | 0.19 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 21.51 |
| Pfam Score | 73.34 |
| Assigned Pfam label(s) | CL0175- PF05764- PF08265- PF04795 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I7JA63 | 20-340 | SKDSKNEDDEYNSSDESSFDEMSVGIALELPKRANRSKKYTQLVGESLEKDQQFWEHSTWDEEKEDEDYNCSEGESFYEYETDSDFD… |
| A0A183CBC9 | 80-332 | LALTRARRPNAGRKMAELMAQQNDKDDDFYGTAYGGFGEGEQDADFESPPHSSDEEEAEVDSDFDRDEDEGDDPAPVEEDPEQIERR… |
| A0A5J5ANP9 | 8-347 | None |
| A0A1C7MY76 | 3-341 | None |
| A0A1Q8RN82 | 25-433 | None |
| A0A5D6Y0Q3 | 14-314 | None |
| A0A4U5PB98 | 44-298 | None |
| A0A2T7PSV0 | 4-274 | None |
| G4ZVB5 | 10-233 | None |
| A0A6P7U108 | 2-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.