DPCstruct | MC36530
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 79 ± 6 aa |
| Standard deviation of domain lengths | 6.38 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 36.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V6IC57 | 20-99 | QNCFAQQTKSWLTNGNIASSTDFIGTTNTQALILKSNNNEWMRITPDGNIGISTTSPKYTLDVHGSIRATKEIIVEKVDS |
| A0A1N6D0Y4 | 108-182 | NWNRAGNAVNEATDFIGSTNSAAVIVKTNNVEAMRVAADGRVGIGNTAPTEKLDVTGNTKVSGSVTANSLDIANN |
| A0A7T9DMF6 | 88-157 | None |
| A0A3G6MKF3 | 147-222 | None |
| A0A437U9T6 | 94-163 | None |
| Q6MPY3 | 655-741 | None |
| A0A1M5FCQ8 | 490-570 | None |
| A0A1M4UG83 | 4-88 | None |
| A0A1M5BD44 | 376-457 | None |
| A0A7T9D9Q0 | 87-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.