DPCstruct | MC36527
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 125 ± 23 aa |
| Standard deviation of domain lengths | 22.93 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 70.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067DAA4 | 22-167 | SSSASPSRCFYTARAYDAAPKPKVNKTCLYRTGKCNNARHVKPNGSLHKMCTYHRSKANENQRRLDQKKKDAGFHRRERISAFKVKG… |
| G4Z2E3 | 30-124 | PLTATSQPPPPSAASGERGAPVDDMLCRYRNKKCGYPRAIKRNGERHNLCERHRAKANQNQRKLESKRRTQKRMLQQRVAAVDRVVK… |
| K3W5F6 | 29-159 | None |
| A0A6G0XWZ3 | 8-100 | None |
| A0A6G0XGL1 | 18-161 | None |
| A0A0P1B5M3 | 14-159 | None |
| A0A0P1AXK6 | 11-170 | None |
| A0A1V9ZNQ0 | 159-314 | None |
| A0A1V9ZXK3 | 11-154 | None |
| K3W7M9 | 2-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.