DPCstruct | MC36526
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 261 ± 41 aa |
| Standard deviation of domain lengths | 40.54 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067D669 | 1-238 | MLPAPRLLQDYCLSYSAPAFLFGTIGGVAYNLCDIDLFRFVYNQFYAAPPYLGMYVNQATWPSGAYVAEGTPAVATFLSSLAVYPVL… |
| A0A6G0XMG6 | 899-1170 | LLYADVARIYYFTTNGFKIWCLSIVMVANFFSFGLVLAVSVLDMVPIQLTFVVSYSAPIFLYSSIAAISIACCIDTLFQFVYNGFYS… |
| A0A397CH59 | 3-285 | None |
| A0A485KCA6 | 414-702 | None |
| A0A067C962 | 313-583 | None |
| A0A1W0A5J3 | 215-442 | None |
| A0A397A084 | 512-799 | None |
| A0A418AQF8 | 342-659 | None |
| A0A1V9Y5Q4 | 358-630 | None |
| A0A6G0XMX2 | 47-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.