DPCstruct | MC36523
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 206 ± 39 aa |
| Standard deviation of domain lengths | 39.31 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 78.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0PMY3 | 142-376 | VTTPPSRRQPALVIAALVYLVISLGIGLWYLSLLSPSLANDLWWAGLTPTGGEALLIDLINAQLALTATSALSIYATDANMNKLYNA… |
| A0A067CFX5 | 7-230 | SHALRPPSRVLVPASWSPRCRVLLGVAYLALSMGCSLLYVQVLTVSFANDLWWSHYNATGYEAFLVDVANDALQTRPNGALDVLHAP… |
| A0A067BIZ7 | 2-182 | None |
| A0A067C4G9 | 5-177 | None |
| A0A067BYL4 | 1-200 | None |
| A0A067BWR2 | 203-445 | None |
| A0A067C843 | 5-186 | None |
| A0A6G0X319 | 2-189 | None |
| A0A1V9YVJ1 | 24-303 | None |
| A0A1V9ZZ18 | 115-336 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.