DPCstruct | MC3652
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 98 ± 10 aa |
| Standard deviation of domain lengths | 10.33 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 55.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0165 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A498P6N9 | 98-176 | SQRGGKTMLVPCDKEYPAFVSERTIKETVGNIDCESCVKSFVIQQIPSSNLFMVVIDNTCDCSDFGPVTMDPIEIMYIL |
| A0A674EA54 | 15-107 | NLYSWWHVDLSVKAQRSRGKTMMVPCDTEYPAFVSERTIKETTGNIDCGGCARSFVIQQIPSSNLFMVVVDNKCDCSSAPLVSMDPI… |
| A0A672NYY5 | 1-93 | None |
| A0A3L8SGU0 | 86-187 | None |
| A0A673H5I2 | 1-80 | None |
| A0A4Z2FW99 | 68-175 | None |
| A0A060XZF5 | 525-635 | None |
| A0A2R8RJ74 | 1-98 | None |
| A0A3M0JVB2 | 179-280 | None |
| A0A3M0JGT0 | 117-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.