DPCstruct | MC36517
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 126 ± 11 aa |
| Standard deviation of domain lengths | 10.54 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D4KA85 | 3-133 | KADYINKQIGDWQAMDFVIGYEIHLSNNHDQDCEMCRMLAGKYPKRFIWHGWHDKCTCFVTSILQDPDEFDNQELDEMKRTLEGHIP… |
| A0A1V5NK82 | 58-187 | NLAYRTADHLRWQQLDFVVGIEIRLSNNHTLNGVPFTDICDDLAGKYPKDFKFTGWHPFCRCNAIPILKTEAEIEQDNDRIDKGRNP… |
| A0A352IC01 | 246-369 | None |
| A0A379G9A9 | 247-367 | None |
| A0A3M9MW34 | 4-123 | None |
| A0A4R6WHG1 | 231-358 | None |
| A0A7C6U597 | 2-113 | None |
| A0A316RI12 | 207-324 | None |
| A0A143XJU3 | 109-244 | None |
| A0A496MMB9 | 207-362 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.