DPCstruct | MC36512
Metacluster Properties and Pfam Annotations
| Number of structural domains | 93 |
|---|---|
| Mean domain length (aa) | 86 ± 15 aa |
| Standard deviation of domain lengths | 15.00 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 93.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01314 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662GNF7 | 7-87 | FNLERCYNIRDAELTRKDDYLPEREFEEPLTIGPAKGTVLSKEDFEKELDEYYELRGWDKTTGRPTKAKLEELGLADVAET |
| A0A7C1W2C4 | 8-91 | ILTIGERAYNIARAFNAREGMDRKDDTLPWRVLYEPIPKGVSEGSHVPPRELEHMLDEYYQARGWSINGIPTKTKLFSLDLNDI |
| A0A7V2PP88 | 6-90 | None |
| A0A0P7HC13 | 18-116 | None |
| A0A7U9BDG2 | 282-390 | None |
| A0A7C4GJ51 | 150-248 | None |
| A0A497NM58 | 6-80 | None |
| A0A7V1N2K3 | 104-194 | None |
| A0A662PRQ0 | 5-70 | None |
| A0A257SS56 | 372-466 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.