DPCstruct | MC36511
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 147 ± 13 aa |
| Standard deviation of domain lengths | 12.54 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16286 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A255SR48 | 322-444 | KTEEGVELMEIVARFADNTVFNDSIAPRYQKDCDEWFAAWKNHPAVVWLHNQLPVYSIGYEAVPWFGAHLLCREDGLDLIPNANKEY… |
| A0A662GN96 | 1-147 | MSKKHVEVYIDPKVELISIIPLLAPWSNVSTRIKEYPYLRGVYNYFGKWKNHEAVQFFTKLMYSGFSIDALLGLPTHLSDPPELKIR… |
| A0A4U9VUJ0 | 1-168 | None |
| A0A1V5UF79 | 19-170 | None |
| A0A318V4D2 | 10-163 | None |
| A0A1E4LES0 | 1-133 | None |
| A0A1V6BW27 | 5-160 | None |
| D9S153 | 1-140 | None |
| A0A351YER9 | 10-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.