DPCstruct | MC36510
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 63 ± 7 aa |
| Standard deviation of domain lengths | 7.08 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 40.00 |
| Pfam Score | 97.37 |
| Assigned Pfam label(s) | PF03621- CL0015 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V3SMB2 | 59-117 | NPFDDPQQDCQVLKNDQQQYSLWPAFCAVPPGWRPVYGPEPQVRCLSWLNENWHDIRPV |
| A0A553ZRQ2 | 2-58 | YKVVVNHEEQHSIWPEDRETPAGWAEAGVVGSKEECLEYIRGAWPDITPLSVRQALA |
| A0A4U5XAW6 | 6-65 | None |
| A0A1H7QWB0 | 2-54 | None |
| A0A3A9YSH2 | 52-108 | None |
| C8XGT9 | 67-133 | None |
| A0A2W6QFQ4 | 155-223 | None |
| A0A5E6UYG9 | 6-69 | None |
| A0A0D8BAB3 | 2-69 | None |
| A0A6H1K3Y0 | 22-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.