DPCstruct | MC3651
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 102 ± 8 aa |
| Standard deviation of domain lengths | 8.11 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 74.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.96 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 65.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P8H760 | 1-98 | MGKRDKRVAYVNPLAARSYAGPSGPTIRDYLNRPRPTWEEFQETLNKSKSGSSTLAAYEEELNQKFKEELRKNRDAINSKTKKLSKQ… |
| A0A674E7P3 | 1-101 | MGKRDNRVSYVNPIAASRAKGPAPNAGPSIQDYLSRPRPTWEEVKEIIERKKKGSRALADFEDQMNENWKKELAKNREKLLGGVDKE… |
| H3AJL0 | 1-99 | None |
| A0A6P5BL73 | 1-103 | None |
| A0A7J7WKZ9 | 1-99 | None |
| U3INW3 | 1-104 | None |
| A0A4W2EN69 | 1-106 | None |
| A0A5C6NI54 | 1-109 | None |
| A0A1S3FY77 | 1-102 | None |
| A0A2K5HX00 | 1-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.