DPCstruct | MC36506
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 360 ± 48 aa |
| Standard deviation of domain lengths | 47.70 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0109 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R8ZAR6 | 9-358 | MEWMYQRTFYYNFENEPILYGRSYTWLCYEVKIRRGHSNLLWDTGVFRGQMYSQPEHHAEMYFLSWFCGNQLPAYKCFQITWFVSWT… |
| G1QB54 | 5-406 | PPACAHRPLIKGSTFKRNFRNKCKNQTYLCYEVEVWEGNAWAPVEELQGFLRNQGADTHRERRHAELCFLDRVPCWNLDGLKKYRLT… |
| A0A6P4VLT9 | 1-374 | None |
| A0A674JML5 | 4-323 | None |
| A0A674JLC4 | 2-353 | None |
| H0Y0C6 | 1-333 | None |
| A0A7R8X842 | 28-441 | None |
| L5K8J0 | 248-587 | None |
| A0A2U8JQ31 | 15-419 | None |
| G1PBV8 | 1-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.