DPCstruct | MC36504
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 118 ± 26 aa |
| Standard deviation of domain lengths | 25.90 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 75.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.16 |
| Pfam Score | 69.32 |
| Assigned Pfam label(s) | PF04678- CL0159- PF20520 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G1Q8H6 | 6-115 | KLCESLKCYQAHLYSTVAPPDEVTVSYRHGLPLITLTLPSRNERCQFVVKPMLSTVGSFLQDVQNEDKGVKNAAIFTADGSEIATST… |
| A0A6L5CK83 | 3-66 | YEVTVEYSRGLPVVTVPLPSRRERCRFTLRPISHTVGDFQSMLAREDRGIDRVAVTTMGMSVIK |
| A0A6A3YN98 | 3-87 | None |
| A0A3P7I9V6 | 51-176 | None |
| A0A813SQC0 | 223-330 | None |
| A0A4U5U8W1 | 3-144 | None |
| A0A0M3HHD8 | 2-78 | None |
| A0A834NJZ7 | 4-99 | None |
| J9A934 | 47-133 | None |
| E4YK38 | 294-416 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.