DPCstruct | MC36502
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 116 ± 12 aa |
| Standard deviation of domain lengths | 12.34 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 36.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S7YNV9 | 15-115 | MKRDPYQTFNLYAKQPQCSSYNIAQLVKRLDTLVLTLKNCQGDSCRHPWKAMFLSGEVTSLQHALATSYDEFFSSQPWVSFDECTQG… |
| A0A4S2MQR2 | 537-647 | RLIGPTYSYLYTHWCTSETELYDTHSDPFELTPIPLTANPRLYSRLNALLLVTKSCAKESCKSPWKTLHPDGTVLNLPQAMDPKYDP… |
| A0A1V6TTS7 | 188-289 | None |
| A0A4Q4YAI7 | 758-872 | None |
| A0A250XMY6 | 648-779 | None |
| A0A2P2HFR1 | 74-184 | None |
| A0A835XSD4 | 719-821 | None |
| A0A2J7ZLH3 | 290-406 | None |
| A0A2H3U2N8 | 1002-1134 | None |
| A0A428PNX4 | 74-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.