DPCstruct | MC365
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 46 ± 2 aa |
| Standard deviation of domain lengths | 2.18 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.13 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 79.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0SQA5 | 1-46 | MQVHLSDWLVKHELIHRSLGFDCRGIETLQIKIEDWDSIAVISYVY |
| A0A3P6H1T0 | 1-46 | MQGTLSVWLAKRGLVHRSLGFDYQGIETLQIKPEDWHSIVVILYVY |
| A0A2U1Q398 | 155-199 | None |
| A0A8A2XXF8 | 7-52 | None |
| A0A5D2F1X1 | 23-67 | None |
| A0A453HBQ8 | 4-50 | None |
| A0A287F7X2 | 2-47 | None |
| A0A7J6ENJ9 | 1-53 | None |
| A0A2G3AJI6 | 1-46 | None |
| A0A5N6PU09 | 138-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.