DPCstruct | MC36496
Metacluster Properties and Pfam Annotations
| Number of structural domains | 259 |
|---|---|
| Mean domain length (aa) | 162 ± 21 aa |
| Standard deviation of domain lengths | 21.31 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 19.79 |
| Pfam Score | 97.09 |
| Assigned Pfam label(s) | CL0023- PF02861- CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D0Y6P4 | 3-157 | SQELRACLMTAMISAKVSRHEFFTVEHLLLALLEDSRTVEILQACSIDIDKLKISLSEFINAVTPLVTGVDSDPRQSLGCFRSIQRA… |
| A0A1H3N3C1 | 3-130 | HKFTESARKVVAGAQDETRKLGHQRIGNEHLFLAALSQYELGIDIDEARQVVQRLVPADQEPGQGHVPFSTEAKGVLEQGLYEATGT… |
| A0A853BSA3 | 2-148 | None |
| A0A535VG03 | 8-178 | None |
| A0A2E0L2X5 | 11-142 | None |
| A0A7G8BJE7 | 2-152 | None |
| D7KK14 | 42-209 | None |
| A0A2M8Q2K1 | 176-350 | None |
| A0A7V9RF91 | 22-157 | None |
| A0A2M8Q2R6 | 7-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.