DPCstruct | MC36493
Metacluster Properties and Pfam Annotations
| Number of structural domains | 141 |
|---|---|
| Mean domain length (aa) | 112 ± 22 aa |
| Standard deviation of domain lengths | 21.93 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 39.99 |
| Pfam Score | 97.28 |
| Assigned Pfam label(s) | CL0425- PF18199- PF00177- CL0021- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A194PW84 | 10-113 | ILRVAASHYSEEDKIFRDSARPGRRTRMRSGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEENDEVLVAGFGRKGHAV… |
| A0A2D3VME9 | 42-155 | QATYNQVLRGCRVEQRARKPTSPALVNRPEMKGVCLRVGTTKPKKPNSGERKVARVRLSSGRVITAYIPGEGHNVQQHSVVLVRGGR… |
| A0A5D2L9X8 | 25-109 | None |
| A0A0D8XN65 | 5-85 | None |
| A0A1R3L0S9 | 4-113 | None |
| A0A445CQA9 | 7-101 | None |
| A0A1B6Q9Z8 | 2-68 | None |
| A0A154PJF7 | 474-578 | None |
| A0A6P8CZN8 | 229-359 | None |
| I7I7W8 | 47-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.