DPCstruct | MC36490
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 108 ± 8 aa |
| Standard deviation of domain lengths | 8.06 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 48.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18149 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A818J229 | 1-101 | SSDLTRTDRTLQPHTIDAFWLERNLSKIYSNVTDAKIKAEEVLDILKTASNNHELENKLIILLGFEQFEFIKTLRMYRQMILYCTLL… |
| A0A820N302 | 78-178 | SSDLTRTDRTLQPHTIDAFWLERNLSKIYSNVTDAKIKAEEVLDILKTASNNHELENKLIILLGFEQFEFIKTLRMYRQMILYCTLL… |
| A0A819LVP0 | 214-314 | None |
| A0A087H582 | 285-403 | None |
| A0A0M3JBA8 | 74-192 | None |
| A0A2N5UKG2 | 532-638 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.