DPCstruct | MC3649
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 65 ± 7 aa |
| Standard deviation of domain lengths | 6.63 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 93.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 61.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3T902 | 1-63 | MTPSVACSPDTPIEVLWHIAQHAPELRRWLIANPRADAALLEFISQAGGPGVKRALAVLLESM |
| A0A2N5JC79 | 50-114 | LTVGVACDPSTEPDVLWHIAREAPELRMWLIANTAATPELLEFVAQAGGPGVKRAFDVLFESMED |
| D2Q7C0 | 2-54 | None |
| A0A430FER4 | 87-156 | None |
| D1NVQ2 | 3-60 | None |
| A0A087DJN3 | 37-101 | None |
| A0A2D3D8C9 | 10-74 | None |
| A0A2K1STL6 | 9-84 | None |
| A0A318M5U8 | 2-56 | None |
| A0A086YYD9 | 69-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.