DPCstruct | MC3648
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 121 ± 25 aa |
| Standard deviation of domain lengths | 25.17 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 82.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 41.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A378XZS4 | 18-120 | ADIAYPTDLSLLNQAREKLEKIIDILHEPERGKTRKPRTYRECARKAYLAVAKQRRVKPRAIRKAIGKQLRFVSRDLRMIAELADMT… |
| A0A6P0S924 | 1-99 | MYRKVESTPSSPEDLGLLNQARVGSEEIIDTLYEAVREKVNKKPKTYRKLARKDYLKVAKKRKPRTKQRKKAIKKQLQYLKRNLGHI… |
| A0A0R2FGJ5 | 74-200 | None |
| A0A1H3Z4P0 | 1-156 | None |
| A0A0R2BPD1 | 17-110 | None |
| A0A345BW36 | 99-201 | None |
| A0A6F9E376 | 7-138 | None |
| A0A6F9ZH99 | 20-122 | None |
| A0A7C2FFX1 | 15-130 | None |
| A0A329A3W2 | 1-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.