DPCstruct | MC36473
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 83 ± 5 aa |
| Standard deviation of domain lengths | 5.14 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 40.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E7G891 | 284-366 | VLVLPEVPLHNNAAELAARAKVRKRDVSLQTITDEGTKANDTFMTIVQTAKKLSVSAYDYIFDRVSKTFEMPSLAQLIRQKAN |
| A0A226WW27 | 5-81 | PEAPLHTNGSERDIRDQVKKRKISGGTRSELGRQCRDTFSSLKATCRKLNISFWEYLTDRISCSDQIPLLPHLLEQR |
| A0A531Z0F9 | 24-107 | None |
| A0A6P0WGJ0 | 65-146 | None |
| A0A0E3QPH4 | 1-72 | None |
| Q117I9 | 109-192 | None |
| A0A1V4S3V7 | 4-83 | None |
| A0A6F8T7T5 | 1-78 | None |
| A0A849T6C9 | 194-272 | None |
| A0A7W1CJ06 | 78-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.