DPCstruct | MC3647
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 217 ± 23 aa |
| Standard deviation of domain lengths | 23.33 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 19.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5M7BUB4 | 1-210 | MAYDLRYLANDRPVSPFEAVPNYKEDLSGPAQPPNTGVPMTRHHIVPYVVLKNYWNMLLDQRRFGDLRLVLREMARMLFRYRLTFDA… |
| A0A6P0RYH5 | 30-255 | TEYNLLMPNERPGAPYSQLNNYNTSLTATGSGSGYPVEVMRHHIVPDSKLKEFWNKMVNNDHLVTAADGLLKVIHDTVDQYQMTLNT… |
| A0A0N7Z3U4 | 394-619 | None |
| A0A4Q6WT11 | 32-258 | None |
| A0A158GF55 | 8-175 | None |
| A0A097EQK0 | 16-218 | None |
| A0A212ESV1 | 4-223 | None |
| A0A1T3NLP0 | 2-219 | None |
| K9WD59 | 287-543 | None |
| A0A0G4F1C4 | 27-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.