DPCstruct | MC36465
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 144 ± 25 aa |
| Standard deviation of domain lengths | 24.89 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 29.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A507F3Z3 | 30-170 | TDGATISSAPSIAAEDRISPQTFKQLADFYFGYDSSASAHPTPLTQNSSIETMIPNRSVFFVNSWEMQAFIEKILPRISVSIVLVTG… |
| A0A6C0HI24 | 6-124 | QIIKGERLQQIADVYIGYPEDFYYNPLISRELTKQRNIHSITSEYDNPKTVFCYTHCLFSFAKLVNYFKNPFVLITHNSDGIIEDDE… |
| A0A507FHH9 | 28-167 | None |
| A0A820K5T5 | 24-169 | None |
| A0A813Z3Z2 | 8-162 | None |
| A0A815PXW1 | 44-191 | None |
| A0A816EPE3 | 49-195 | None |
| A0A820ZIN5 | 35-194 | None |
| A0A817MGJ5 | 1-139 | None |
| A0A817MUJ4 | 12-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.