DPCstruct | MC36462
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 218 ± 30 aa |
| Standard deviation of domain lengths | 30.01 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 25.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00995 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9PLC3 | 169-309 | SEAFFDNLTVEQEFMTGVETDKVNTYIEDSIAQKDPLIKILRLVSMQSVCNNGLKQKVFDYYRREILQTYGYEHILTLNNLEKAGLL… |
| A0A507E146 | 5-241 | RDAKTISQIKDFIGKIGGIEGEKAYLKLHTSIAEEISKNTQDPAFKKFLELQQNILSGNVMASQTDYIEELIDKQAPISQTLRLMCL… |
| A0A7R9NZB0 | 628-851 | None |
| A0A2G8LLZ2 | 194-436 | None |
| A0A1V9Y672 | 521-737 | None |
| A0A2P4ZBU4 | 539-810 | None |
| A0A7S4KP01 | 331-511 | None |
| A0A6G3ME17 | 164-338 | None |
| S4NTL8 | 1-201 | None |
| A0A830HUV0 | 381-620 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.