DPCstruct | MC36449
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 270 ± 52 aa |
| Standard deviation of domain lengths | 51.92 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 17.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07163 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q2DF32 | 36-278 | PPAATNGSPSTSAAPLRSLYTRAARAFLHRDIRLTYSLIESAFQLLRPPVLVHDALLEHRRKWDILRITLETTIYSDPPSIESLPES… |
| A0A2V1A6H5 | 11-250 | QSVILNDYKLAVKFFMNKDFEKSYQIISKLHSVAYRTFAKGAISEDVFVKIVTLYLTELGLLLNSKDGTFQLPRKEKKELIGKLRSS… |
| A0A1E3QLS0 | 4-379 | None |
| A0A2T0FG48 | 30-320 | None |
| A0A4R0R5P0 | 11-287 | None |
| A0A177WSZ5 | 9-296 | None |
| A0A395IJR3 | 10-244 | None |
| A0A1E4SYJ8 | 31-441 | None |
| D8QQK7 | 9-243 | None |
| A0A6M7YMH1 | 1-349 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.