DPCstruct | MC36448
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 241 ± 32 aa |
| Standard deviation of domain lengths | 31.78 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 28.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q2DDT8 | 4-250 | TAGDEDYGFPAGYFVVRSAGSDRSLDVAGDSVKDGSEIILYPEKEKSLVEAFRDPGANNQARSMASHWDDRLVLRHRHPTTYPYPNK… |
| A0A409Y4B3 | 99-314 | LSSTSGDASSIPPHSKTTGFPSGYFRIRAAGTNHYWGVHCGDVHEDGNGLQLWNLSGKSQAEKFFFVNAKGGLCTRGLPIDVMGSTL… |
| A0A409XZK9 | 257-484 | None |
| J7SCG5 | 97-356 | None |
| E3JZZ4 | 76-363 | None |
| A0A167XPN4 | 262-464 | None |
| A0A409VEU6 | 1-273 | None |
| A0A166FQI3 | 150-381 | None |
| A0A167W5K7 | 488-694 | None |
| A0A0L0UU54 | 23-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.