DPCstruct | MC36444
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 318 ± 57 aa |
| Standard deviation of domain lengths | 57.02 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 72.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y7R5I0 | 40-308 | TQADPAHWDQLWDSFDRYYTANEKEIMEAAKLDVLEIAGSKRSMQKDALVTSFLEHSKTILNGLQFLSELHPAVSVVVGAFGALIKI… |
| A0A4Q2D2G3 | 6-314 | DRYYIENEKVIMGAAQLDMTEVGQGSSKKALRYEAAMTSFLENSKTILHGLQFLSEIHPAISVAVGAFAAVIKIELIRRDNNMKAMS… |
| A0A1C7LPZ9 | 1-310 | None |
| A0A4Q9M5F8 | 51-364 | None |
| A0A165T0I8 | 84-529 | None |
| A0A4Y7QDV0 | 3-398 | None |
| A0A2G8SI07 | 1-301 | None |
| A0A0C9TRM9 | 6-271 | None |
| A0A0C2WNX0 | 1-273 | None |
| W4JXI8 | 3-301 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.