DPCstruct | MC36441
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 235 ± 34 aa |
| Standard deviation of domain lengths | 34.09 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 71.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q5U859 | 1-231 | MSANREIFNEPCLTISNQLSDFITRRHDKALRPLHFADMSLLQFSAELECYLSVLDSGGSIALCRGEKLASIHLSQRLETIFKTPLP… |
| A0A1M3SYV6 | 21-245 | DFSSPPADHPLPSLSVYTQRLAHVDEGLKLYLSTVEQGQSLAANRGEAVSASYLTQQLARLFTTTEPETVRGPRIDWAQVILRQNAL… |
| A0A1Q5UCV3 | 37-275 | None |
| A0A229XVR9 | 1-251 | None |
| A0A4V1XRQ9 | 2-208 | None |
| A0A1M3SYQ9 | 2-196 | None |
| A0A1V6TIH8 | 2-256 | None |
| A0A6G1HK24 | 60-376 | None |
| A0A401L1W2 | 1-243 | None |
| B0YE45 | 3-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.