DPCstruct | MC36440
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 342 ± 86 aa |
| Standard deviation of domain lengths | 85.96 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 74.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 22.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A175WCR2 | 12-372 | DESRYADVLGAKKHMNFETARCLSRYLLGEEFAGKWYYCSDEKSKNPRLDSVIQGLGCEGVELTNMYWAILRRYKLIRTAEEEERRR… |
| A0A1Q5U0Q9 | 72-365 | RQVRQIWEEALREKEDTVLPLLTTNTIRDSLGKRPARLPDTLWQMLRAHCPIRTVEEEQQKQFKEAKPCIVPDTTFARAVDRALRAC… |
| A0A6A5UDA5 | 238-781 | None |
| A0A1L9RD86 | 291-672 | None |
| A0A6A5VPX7 | 82-580 | None |
| A0A395HH48 | 4-267 | None |
| A0A6M7YU40 | 543-875 | None |
| A0A319DKD5 | 4-334 | None |
| Q2U1J9 | 2-261 | None |
| A0A2V5IQM4 | 401-718 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.