DPCstruct | MC3644
Metacluster Properties and Pfam Annotations
| Number of structural domains | 87 |
|---|---|
| Mean domain length (aa) | 247 ± 41 aa |
| Standard deviation of domain lengths | 41.22 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 16.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N5TW34 | 57-289 | IPTAPEVAESSSRVREVTNQNQGPSLREEDKTILRLIKYTGNQAIAPTAEEYHRKFRTESGSKQFQCCKSSERIMCDDLPLLVTAPA… |
| A0A5B0SDE8 | 2-168 | NQIVHPKLPIATYFLVQYPEHKVMHILRHDKSNRSMQHEDVFQKLKKLMIAINCIHMRSFAYFGIKEAEYDASCETLDRWLISIILK… |
| A0A2S4WII1 | 385-655 | None |
| A0A2S4WFX9 | 7-208 | None |
| A0A2S4WFS5 | 140-416 | None |
| A0A180H3D3 | 81-402 | None |
| A0A180GTL4 | 103-364 | None |
| A0A2N5SLM6 | 427-678 | None |
| H6QSP3 | 39-247 | None |
| E3L5Q4 | 16-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.